DPCstruct | MC7123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 7.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383VS61 | 63-123 | VAVEADGPTHFREPDGGLKGPTKYRNRALAVRGYRLISVSYRDWAKLQGDEQRQQQHLLRL |
| A0A2C6LCM1 | 31-91 | HTKGIVLEVDGPQHFYRDSFHWTSSSKLKHRLLTRLGFRVVHVPYFDWLKLHTQNLRRAYL |
| A0A7S1SD10 | 97-156 | None |
| L1IVT9 | 32-95 | None |
| A0A820XHY7 | 81-146 | None |
| R1D482 | 48-108 | None |
| A0A812VGF9 | 46-129 | None |
| A0A813G135 | 107-183 | None |
| A0A7S0QTM3 | 339-395 | None |
| L1JQF1 | 107-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.