DPCstruct | MC7122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 187 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MB59 | 7-166 | EDGEKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPHKYYELYMRAFDELRKLELFFKEETRRGCSIVELYE… |
| A0A0L0CX39 | 1-180 | MSTYKDNNNHNNHNSNMNTIDQKKFLDECIFVVKEQSFYMKQALENGSLRDTLKYASNMLCELRTSHLSPKYYYELYMLIFNELQHL… |
| A0A6P5VT95 | 7-196 | None |
| A0A2P2MB20 | 1-174 | None |
| A0A0R3T432 | 6-158 | None |
| T1GWA6 | 1-186 | None |
| A0A3R6Z982 | 379-535 | None |
| V6LYG7 | 16-217 | None |
| A4HZ46 | 22-206 | None |
| A0A7J8CMZ3 | 4-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.