DPCstruct | MC7120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 203 ± 24 aa |
| Standard deviation of domain lengths | 24.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 64.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1R2H0 | 1-202 | MTSDPGPPQPYLVQPTGAPVLILPYTAPHLLPYPSHSGITGSTNLMIHYGLQNSYSKFCKKEGKEELSAFLPNLPGYIDTPGMQDNS… |
| A0A654HPC4 | 4-162 | EPPAPDATLTGAKNLIEHYGLESAYQKFCGRKLRDELSAFLPHLSGNVNMPASEDGSGLLGLVERPPITGKELMPFAPNQLDHGFRL… |
| A0A3M7Q5W8 | 33-212 | None |
| W5PKQ0 | 2-251 | None |
| A0A5J4ND20 | 1-212 | None |
| A0A6P8HMG8 | 1-200 | None |
| G4VKK2 | 7-213 | None |
| A0A6A4V6U3 | 2-183 | None |
| A0A5K3EQY9 | 2-200 | None |
| S7Q7B3 | 1-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.