DPCstruct | MC712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 182 ± 29 aa |
| Standard deviation of domain lengths | 29.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6DGP1 | 43-239 | QTKEEVIETNERLRLVRIRLEESYDTAKRALVGLMGKYNESKTVRNVFQRYTMLKAMIKDVIRLETQYWTLVDIPKQEKQETVPAFV… |
| A0A1W0WJF1 | 56-244 | RLDTIVIHESLIASLEKLAESYELIHNALTNLHQQYSKLLETWNPHQRYSSMKLMIKLVLRINADNSKALLIPSQEPGELPLAYAQR… |
| K7H1I1 | 162-378 | None |
| R7TA24 | 3-186 | None |
| A0A1S0TSV0 | 3-112 | None |
| A0A084WSQ8 | 436-639 | None |
| T1JF54 | 43-204 | None |
| V4A2C0 | 7-215 | None |
| A0A834K5M5 | 14-200 | None |
| T1KJR1 | 27-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.