DPCstruct | MC7118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KRS1 | 288-354 | VPFRVTIPTAHAVAVVVGEDWTHLSKVNDCWIGQVCLKPYWGIENQLALCAKYNVDDGNYGTLLEYR |
| K1R163 | 1-84 | MWEPLVVHKEIGKPKVNFHVKIPKAEAVAVVTDQEWTHLQSSQPGIWQGEVNLAPYYGKGVKFTVNANFGGDKTSYATLLEYSI |
| A0A3P7LNC6 | 1-70 | None |
| A0A3P6QVL6 | 98-164 | None |
| A0A183T0T3 | 589-655 | None |
| A0A5K4F480 | 1296-1362 | None |
| A0A8B6H1P0 | 1020-1103 | None |
| A0A7M3R2B1 | 435-504 | None |
| A0A5J4NV08 | 257-324 | None |
| A0A504YY26 | 910-976 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.