DPCstruct | MC7117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1R0U4 | 1-91 | MSRQSTPDILCWQHCDKLTNILCFSVPLVCPLCHYNTTHSPSRIPPYKLPSPLTNAGESPVSLVVRPTVGTFLRNYDNSVNLHIGVT… |
| A0A6J8A777 | 4-88 | HDIKCFQHCEKGLNILCFTVPVVCPLCGVDVTSTPCRIPPYIISTPFVNGKGYPCSVIIKPTVGTFLQNYSNNSDLHVGVTDSAG |
| A0A673TC08 | 1-76 | None |
| A0A0L7L1E8 | 3-85 | None |
| T1JUW0 | 152-244 | None |
| A0A7J7UJW4 | 3-108 | None |
| A0A0C9R2G5 | 44-133 | None |
| A0A6I8TVW5 | 1-88 | None |
| A0A553PAU8 | 1-88 | None |
| A0A0J7L5Y7 | 83-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.