DPCstruct | MC7113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 143 ± 23 aa |
| Standard deviation of domain lengths | 23.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7VY03 | 3-114 | DITFVSRLEACTLAPEHFNHAGHVRLACLYLDRYPLDEAIARTCATISAYATHLGGANKYHATITVALVRLLHAHGPTVLADAPALL… |
| K1QLL2 | 128-258 | VGDEIFIQAFEDATLPFEDWTHEAHLRMAWNYITEYGKQGAIPHIRLGIQNFNEQNKDKVKFGFHETITMFYIAEVAHAIKKSPGVS… |
| A0A433DJ02 | 151-322 | None |
| A0A812BSV3 | 171-278 | None |
| A0A0G4HB99 | 118-289 | None |
| A0A2M9D7W6 | 1-121 | None |
| A0A316FXN1 | 9-137 | None |
| A0A6A5V978 | 182-335 | None |
| A0A661FYX1 | 15-139 | None |
| A0A0U3AH87 | 10-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.