DPCstruct | MC7112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 160 ± 42 aa |
| Standard deviation of domain lengths | 42.18 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183EZR1 | 36-158 | ETEAIANKWYKWLGDPFSSMIVAYLIRPFPDLRMASLRLVFELIGYKWAIGTLCRTSNFLDNVMKREIETAAEGRQCRYDIVCKLID… |
| K1QKD9 | 33-165 | LQIAEQTDELQKLTEKWFNLLSNNSFETLMSLVRQPFTDLRCSAHCVLLSLALQPWGQTLMNNYPGFTEFLLDRSTEKTKETKESKF… |
| A0A7S2LXS0 | 11-126 | None |
| A0A7S0D0C3 | 509-682 | None |
| A0A7R9WP58 | 5-270 | None |
| A0A835GBZ7 | 638-798 | None |
| B7P6L7 | 156-318 | None |
| A0A6I8RWY6 | 708-900 | None |
| V9ILI3 | 1-105 | None |
| A0A6A4VGT9 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.