DPCstruct | MC7110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 290 ± 33 aa |
| Standard deviation of domain lengths | 32.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1QJP2 | 27-288 | IKLIVCNGGAARGISFSQAKASEGLQIEKQEPERNKSETDWAARLAIHFFSPLSQTKDYVLDNHGLKKCERCPCSCNKIIRYGDTSI… |
| K1R523 | 32-326 | LVFGDVFRNGMDILVNYIKDKSYPDNKEQILVLNKLLKFMNGDRKISVHGLQKFSGKELTKLVANHLFGKLATSSYYLVDKKISIGP… |
| A0A8B6CQ50 | 4-282 | None |
| A0A8B6CPG0 | 132-435 | None |
| A0A210Q118 | 171-502 | None |
| A0A210PH74 | 72-417 | None |
| A0A8B6F4Y0 | 113-370 | None |
| K1PWW7 | 2-228 | None |
| K1R9N6 | 5-314 | None |
| K1PWB1 | 383-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.