DPCstruct | MC711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 163 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q0FD56 | 100-251 | GMKDPQLFLKNVIKPTLLKIGLSSKKAEVLLLGTAIQESRLKYRQQLGGGPALSYFQIEPATHDDIWDNYLSYRGELALKVKSLMTS… |
| A0A1W0WJD2 | 10-177 | GLTVAHWVAAQDQTLVSGASGTAVAKAAVARVLGCGIFPGDNGLLRKIGWVESKDGTDPNTYRPNYHGGIWQVDSIGFLDTKTHPSA… |
| T1F7N9 | 46-220 | None |
| A0A0Q7TP25 | 149-349 | None |
| A0A521H2A3 | 198-366 | None |
| A0A2D6QL67 | 9-133 | None |
| A0A2A2FX51 | 30-182 | None |
| A0A1Z9Q572 | 775-937 | None |
| R7LC94 | 81-245 | None |
| A0A1X7SS99 | 37-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.