DPCstruct | MC7108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1QV68 | 52-149 | MFKVREKRCSFNQTVYEKDRDSFNCQSSINVYHCIQNERNRSGEICIQPVWVQPNYCPEYNTGANTLDTVPCNESITGSCPHALFLS… |
| K1QH59 | 1-94 | MFNVIKESCPYQNWTSVARERCPNPDHFHCLIDEYGRIGWVCKEPIWVEKDRCPVFNVVAKKLDTTSCSQTRCPPYSYRSNDVDVEY… |
| A0A6J8ARD4 | 5-103 | None |
| A0A8B6BQ90 | 28-126 | None |
| K1PY52 | 2-95 | None |
| K1PVP5 | 1-107 | None |
| A0A6J7ZW42 | 29-127 | None |
| K1QQJ6 | 1-111 | None |
| K1QIK5 | 1-94 | None |
| A0A6J7ZUP7 | 15-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.