DPCstruct | MC7107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 199 ± 31 aa |
| Standard deviation of domain lengths | 31.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9DQS0 | 12-179 | GWADAMAKVLKKQPSNATESTILAKAKTIEDANEEDEKERKARRKRVNKKRKWENMCRVIPTKEDEVYEKELRKVATKGVIQLFNAI… |
| K1QGN8 | 19-190 | ATSGSEQDSKAGLADAMAKILKKQIPAHQQIILAKGTTDKELAKKRQNIDEDSRETQKRLWEEMGRTKPNPLEKERERKLQRIAQRG… |
| A0A218UB45 | 53-252 | None |
| A0A3P8Y3U3 | 88-301 | None |
| A0A151P4A8 | 2-210 | None |
| A0A068Y4F0 | 3-187 | None |
| A0A7J7KKM6 | 51-307 | None |
| A0A6L5DE09 | 56-275 | None |
| A0A3P9JVN0 | 45-267 | None |
| A0A183WQ23 | 75-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.