DPCstruct | MC7106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 274 ± 38 aa |
| Standard deviation of domain lengths | 38.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9LFR9 | 114-352 | LTTLVQIQRIAYSSEAERTPKSVLRMRNMTWYHGILCREELGFKLKEITTRKLYGNYYHNITSHAAIQHRLISGKACNVEEQERIFN… |
| K1QGN1 | 1-293 | MTSRKFYGAHFHSLTTHAPEVYRVFCLRSVIPEQEERGFGDLRRISENTSNRQAEYVIDNAVMRFNAQQNDEHREDAFSIQESVISH… |
| A0A7D9HRK0 | 520-891 | None |
| A0A6P4Z5T1 | 627-939 | None |
| A0A6S7FZP7 | 65-362 | None |
| A0A6S7GXW1 | 393-649 | None |
| A0A7M5V8A4 | 154-394 | None |
| K1Q0D4 | 11-241 | None |
| A0A7D9L916 | 1-273 | None |
| A0A7D9HHG8 | 662-913 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.