DPCstruct | MC7102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 585 ± 151 aa |
| Standard deviation of domain lengths | 151.40 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6LVK4 | 2-860 | ADNKSVAFCVCEFLACDRNEYNIQSSCRSLSEWKDDNMIQSKVNALLAMLTKYKKFVHLKQLFIAVLTSYMTFDDLSTQLQEFSHFC… |
| K1QFC3 | 142-811 | QEIDEKTLKSWKSLKIGEVCCINEEDEGSSQYQSNVVLYKDLLSKLNFIVKNIFRYNESKTFHKILKRNARMQKKTADLKFDDVIDI… |
| A0A816EJH5 | 225-713 | None |
| A0A821ASS5 | 29-387 | None |
| A0A813YVZ0 | 119-789 | None |
| A0A1Y1WDZ0 | 3-273 | None |
| A0A1Y1XVA3 | 1-585 | None |
| A0A8B6BYK0 | 1-708 | None |
| A0A816DD46 | 481-1093 | None |
| A0A819CQ55 | 8-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.