DPCstruct | MC7101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 10.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6FLJ8 | 5-106 | VSSMTTKEPIENERFRFRYDPQSMILMAINHHKCYLYATSGSESTDVHTTTGLHLLELKIITLIDDDTAMYTSITHDALKAESTLLG… |
| K1QF57 | 137-230 | STHEANINEAFSFHYDAHSTSLAVKTHRHCYLYMLTADEQTAVHTSTGLHSIEKTVIDLIDANSATTAVSAQDLTTMSHGLSHFCGK… |
| A0A210PJD6 | 78-192 | None |
| A0A8B6CM87 | 71-184 | None |
| A0A8B6BPA2 | 20-139 | None |
| A0A8B6BP41 | 17-120 | None |
| A0A210PV13 | 22-118 | None |
| A0A210PUX7 | 22-124 | None |
| A0A210PGR4 | 37-140 | None |
| K1Q0Q3 | 117-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.