DPCstruct | MC7100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 12.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16206 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XBU3 | 139-265 | QNIIKTLRMPLGLKYACPSESTWKLAVSSLLKVLSIGLPVARQHASSGMFETMWPELANAFEDFLFTKSTPPDNVSIQEFQKNEAID… |
| K1QEY9 | 1-132 | MWKHPQTFRLPLSYKYTCPSPSTWVLVINSLLTVLGVGLPVARKQGAAFQDMWGELARTLEDFLFPKQPSPSTLSMEDFQRDEAIDC… |
| V4AFH7 | 392-529 | None |
| A0A0D8XJY0 | 480-597 | None |
| A0A4Z2HQV3 | 696-851 | None |
| A0A0R3R368 | 35-156 | None |
| A0A812D7N7 | 185-316 | None |
| A0A2D4IJP8 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.