DPCstruct | MC710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A0L050 | 22-94 | SVQVTGGHMTSDGTRHHADYVGDSLWVVDYLPGRQLTREQATAAMRIAVAPERLEVDRWASLLGLTAAEARGF |
| A0A6I2G6L4 | 30-119 | RVYVCDWSITSGAVGEFAERLPDDGEARWRVSWLPGRLLTRDQAIAAMEMVELLYDTTRPTDEDLRAAIAAAAELLGIRPIDAAATL… |
| A0A0B8NNK3 | 2-95 | None |
| A0A7K0CV94 | 6-87 | None |
| A0A7K0DBL3 | 1-79 | None |
| A0A7K0DF81 | 2-74 | None |
| Q5Z318 | 7-102 | None |
| Q5YVM9 | 40-133 | None |
| A0A4R1F6Q8 | 1-93 | None |
| A0A379JJJ6 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.