DPCstruct | MC71
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 143 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 67.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4HUQ7 | 47-181 | EKASSKFLLGYSLLFSFLFLAFFGIVTFLIPTPFFTRMTPKTFFDYGYWILTSALFGTYIAFYCYNKKAQAKCTVTAAGGGIFGFLG… |
| A0A7C6LUJ9 | 10-156 | RTWTPRRWVAVAVATVGTILLIGLPTVLIPNPVFGREIPMTWWAWPALLVSAMLSGLLVGTYVRAPRPSGHEDEGTRRGMLGGVLTF… |
| A0A6B8VX77 | 12-117 | None |
| A0A4T0UWF0 | 1-157 | None |
| A0A4Q1KYB5 | 22-190 | None |
| A0A1D9MMI4 | 4-123 | None |
| K6ULP9 | 46-205 | None |
| A0A0B2AP57 | 2-149 | None |
| A0A5B0EHH6 | 23-168 | None |
| A0A7I9VCD6 | 3-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.