DPCstruct | MC7099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 144 ± 21 aa |
| Standard deviation of domain lengths | 21.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 96.97 |
| Assigned Pfam label(s) | CL0063- PF10231- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1QDV3 | 23-164 | IIQFRDLHNQGKSELHIYNVPPPSKKYDLIGPPDKKSNLRPVVFHVPQKETALQCRYRLMRKETHDWNQAFWANHNERFFKEKEDFV… |
| A0A5E4N348 | 1-123 | MNNVDSVGPPDPVSNLRPIKYHKPKHESLVERKLRLKRIEVAKWNHEFWSSHNLRFVKERDAYKKCLADKGIPTANADQMSEFYKDF… |
| A0A7J8JWE5 | 3-158 | None |
| A0A7R8X987 | 197-329 | None |
| A0A1Y2HX76 | 2-119 | None |
| A0A507ED59 | 8-144 | None |
| A0A1R0GZK3 | 29-196 | None |
| A0A6A5DBD5 | 26-181 | None |
| A0A0N1I492 | 2-122 | None |
| A0A1I8F377 | 473-605 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.