DPCstruct | MC7097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2BR37 | 298-423 | AIWTQFPFTTDSHSDCHGKQYVKRTWYRKFVGVQLCNSLRYKIYLSDTLNGKFYNIGDQSGFGEDHCQFVDSFLDGRTGRHLRADLL… |
| K1Q9Y3 | 116-254 | FIKHCFKTPASCWIQYNFTYDNTWDGCTGGTRYVRRTQYPSAPYVGVVLCSPTRYKIVLGSAFTDKFLGVGDGDGSGADHCELVGGY… |
| C3Y5J3 | 409-547 | None |
| A0A6P4Y5I7 | 167-300 | None |
| K1PJS1 | 1-126 | None |
| A0A4W5P465 | 71-201 | None |
| A0A6P4Z0E3 | 191-337 | None |
| A0A4U5UL53 | 357-482 | None |
| A0A6J8AWU7 | 618-745 | None |
| Q2Q0I9 | 1646-1776 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.