DPCstruct | MC7095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 191 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1DD37 | 503-675 | VPDSEADVYELLYERIFALESIQCDKDSCYAAVPDWWQIRLGADIPQAIVQYAEVKDNNKFGSPKYVVSIPHYGKSKEATKSSDFPT… |
| A0A7Z9E082 | 189-361 | QSVQHLIQSTTATYQLLENRDIGTGINVLYDDIPITESNGIEITLILYNYEKPPYWTKERRKDLVKSEITIPNCKRSIISFERLKSL… |
| A0A1Z4FTS7 | 146-333 | None |
| K9TCA8 | 111-357 | None |
| A0A218QL16 | 96-295 | None |
| A0A1W6EGE0 | 1-178 | None |
| A0A6P0RAE1 | 180-393 | None |
| A0A2G7GP03 | 87-318 | None |
| A0A6N8G294 | 60-200 | None |
| A0A218Q7Z5 | 18-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.