DPCstruct | MC7092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 4 aa |
| Standard deviation of domain lengths | 4.23 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848EFE2 | 18-113 | CSEDFTEAKPANGGNERTLSRTELRWCMFNDIRIEAARPDMRGAKQGQVQAFNAAVTEWNAACRAYRYSRGDREAVQRQIEARRQQL… |
| A0A5B2VAX7 | 1-95 | MVNEIKPAVGTGNALSQAEIRYCLSERIRIETMEAVVNTQFSGQVSRFNASVDDYNSRCANYRYRRSDMDAARSAVEANRASIESAA… |
| A0A3R9BPI8 | 293-386 | None |
| A0A4Y6W075 | 553-649 | None |
| A0A6M8VQJ0 | 140-231 | None |
| A0A4Q7VPC4 | 115-204 | None |
| A0A1B3LPN0 | 119-212 | None |
| A0A318B8N8 | 155-255 | None |
| A0A2G6ETD0 | 214-305 | None |
| A0A7V8C0C8 | 137-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.