DPCstruct | MC7089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 151 ± 22 aa |
| Standard deviation of domain lengths | 21.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.66 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0167- PF17219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M5X3C6 | 1-132 | MGDGKWECSVCTYKNKSEAFKCEICDTRKGTSTRKPRVTATMVAQQIISSFPPIPPMPPSNKYQKSNSGGKRLRKSMQSASKLKNID… |
| H3FVQ2 | 2-158 | ASAKKKAKKERIDDGDADEGTAWDCTVCTFKNKSEAFKCEICDTRKGTSTRKSRLTHEVQQMQSAVHHLVLQNQKIPPISHKRKTQL… |
| A0A1B6GKH3 | 1-149 | None |
| A0A5K3FI17 | 4-180 | None |
| A0A6J1XGU3 | 1-175 | None |
| U4UU28 | 60-201 | None |
| A0A2W1BKW9 | 73-179 | None |
| A0A7E4VX05 | 3-172 | None |
| A0A6B2EGY5 | 11-157 | None |
| A0A1X7V7X2 | 6-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.