DPCstruct | MC7088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 117 ± 17 aa |
| Standard deviation of domain lengths | 16.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673JSW6 | 6-99 | RECLYFNINWEVEKTNRSGVERCEGEKDKRSHCYASWRNSSGSIELVKKGCWLDDFNCYDRQECVATEDNPQVFFCCCEGDFCNERF… |
| H3FHG9 | 6-128 | FLLALSAPFAAAVMGELSKELLNEGLVSLDENGLLTTTCMVSLKDGSTTVQSCPLAPGFGPQGVGCFTVWNSAGFIQQGCYSSQEIS… |
| A7RR40 | 15-126 | None |
| A0A0D8XVZ7 | 10-129 | None |
| A0A2A2K9L8 | 22-133 | None |
| A0A2H2IXB6 | 1-182 | None |
| H3EBV1 | 571-665 | None |
| A0A1I7YUX8 | 96-207 | None |
| J9KPA2 | 1-104 | None |
| A0A2A6D2V4 | 25-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.