DPCstruct | MC7086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 272 |
|---|---|
| Mean domain length (aa) | 313 ± 82 aa |
| Standard deviation of domain lengths | 82.30 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.30 |
| Pfam Score | 99.72 |
| Assigned Pfam label(s) | CL0347- PF00858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3FC00 | 648-966 | VPFVIGLQSKENRTRLSWNVEDMFMWIAYEEKKLDLNKDLVAWNDVVLGNCFTFNHFNNTERSYLMRSDGSMGGLKAALKLNSEEYV… |
| T1IVZ0 | 137-433 | AYQIYYLIDSYFEYPLYKTVSLVRDDIIQFPLIITCDEESHEILNAKKNLAKQLNTDCDRYQLWDLLHQSSQFANKPLQLWNASSTF… |
| A0A1I8I318 | 457-1081 | None |
| A0A4Y2TYG2 | 2-180 | None |
| A0A3Q0JDI0 | 32-268 | None |
| A0A6J1WHM5 | 28-287 | None |
| A0A7R9A7K9 | 12-213 | None |
| A0A2R2MRR2 | 7-212 | None |
| T1EVW3 | 10-281 | None |
| T1F0G9 | 261-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.