DPCstruct | MC7084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 5.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9H9G1 | 1-88 | MGHYCRICGCERPNEQFSGKGHTIHVCKRCQARPKSERLTIGDKDDIFGFLQQSHISERNVARLERMAKSDNPQVASLAAIVLDVARV |
| A0A0U5NQ48 | 4-98 | RKIQGLYCKICGQRKSNESFSGTGHANHNCKSCSRLSSVEQAEAIKINRLISLPCRRLTEEDQKWLKNRTKDFSEEVRTVAREIYKQ… |
| A0A3M1TD70 | 2-99 | None |
| A0A2V9CCN1 | 2-103 | None |
| A0A1F3VMX8 | 41-142 | None |
| A0A3E3I2Z6 | 3-95 | None |
| A0A349UMI2 | 2-87 | None |
| G1VEX8 | 4-98 | None |
| A0A644UM10 | 1-100 | None |
| A0A844DX45 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.