DPCstruct | MC7081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 467 ± 63 aa |
| Standard deviation of domain lengths | 63.27 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H8Z957 | 160-630 | PDSFDEFSTGAFLNSLGFLIQMYIFEFIDNAHDVIEFVQAVYEILIEYLPSNSNALNKQTQKAFRLFNRCFAPIDNISIGLEYIATA… |
| A0A177EM66 | 17-471 | YQKKTEEIVNFFKSLVNTDPDCYLKVPNEFQIPTTYKEFLTGNFLNSPKFLIQSYFFEYINSVGMHEEFVKAVYELLTEQMPKKYKS… |
| I3EFU1 | 27-433 | None |
| H8Z9Y3 | 20-443 | None |
| A0A3D2KRY3 | 214-558 | None |
| I3EI23 | 1-473 | None |
| I3EDV6 | 10-465 | None |
| I3ED34 | 3-504 | None |
| A0A177EPT1 | 245-710 | None |
| A0A177ELT0 | 213-779 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.