DPCstruct | MC7080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 168 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177EK54 | 561-730 | SMNIMISILEENIVEITWQVKKQHGLGEYTNYKLDLIPWNRNCTKTQFDYKNTLNIAYSFLNIFQKKHISQDMSYYGIFIYSLKHKN… |
| A0A177EK46 | 1-187 | MDITWNTRIYESVYEYTTYKFDSKIRDERNHISTINQPVITSFINMLQRKNPSINSALYGHCLYKNINTDQYNSSSVFCLVMKDLLS… |
| I3ES54 | 771-915 | None |
| I3EP05 | 903-1077 | None |
| I3EHR0 | 152-300 | None |
| I3EHE6 | 188-360 | None |
| I3ED87 | 1-169 | None |
| A0A177EFV2 | 849-1022 | None |
| I3EGV8 | 332-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.