DPCstruct | MC7076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417N801 | 2-76 | DKNQGYEIIKAVMLENGRGFALGHNPAAPSPYVTWACYDDKDGQRQYEWGHYGSDRTALEQDFAARVQEYRRLYN |
| A0A416H6V5 | 148-231 | QEKNGNYKIIASFDIGNSSVVLGYNEKSPSPYVTWKTTPDRKNGYYTGHYGVTKESAFNDYKKRCKECFNEHLNKESQKLGIKD |
| A0A1Q6L0Y0 | 180-267 | None |
| A0A416PAF5 | 168-266 | None |
| A0A1I5THH8 | 2-99 | None |
| E7G799 | 156-230 | None |
| A0A7U9MZ41 | 109-208 | None |
| A0A136WH56 | 255-342 | None |
| A0A358ATN3 | 281-383 | None |
| A0A1C7GTN3 | 2-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.