DPCstruct | MC7071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 321 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06483- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559IQD1 | 352-674 | MQAGRINVGVPYYTRGFKNVQGGTNGLWGKAATMNCMPGEFKCGDGAIGIDNIWHDKVNGLETPGGYSPMWHAMNLENEIRGSYLNM… |
| A0A0N9I744 | 1-306 | MPTVFPRLRTELGRIYGRLVAGNLWHDSTAAGDEVPSGVNPMWHAKNLENGITPDYLEAYGLDPSDPKNQLTGVYDRHYDATLVAPW… |
| A0A6S5IHN0 | 1-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.