DPCstruct | MC7070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 20.04 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 62.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287R2B9 | 268-409 | IKSLGLDHKAIDKCIGDPNADEENPVLKAEQDAQIGKGARGDVTILPTLVINNRQYRGKLDKGAVLKALCAGFQETTEPAVCLSEDI… |
| B9TFP0 | 13-145 | LPLDKIKKCMGEPEADVENEVLKTEQELQVGRGSRSDVTILPTLVINNVQYRGKLERTAVLKAICAGFKETTDPPICLSSDLETNEC… |
| A0A5J5ST26 | 209-344 | None |
| A0A7G2EWF4 | 1-119 | None |
| A0A287R1X6 | 60-157 | None |
| A0A3B6RJ58 | 1-99 | None |
| A0A446IS12 | 488-624 | None |
| A0A453KD75 | 174-271 | None |
| A0A0D2L5A5 | 187-302 | None |
| A0A287H7Z3 | 2-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.