DPCstruct | MC707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 254 ± 25 aa |
| Standard deviation of domain lengths | 25.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417Y7D2 | 177-416 | GADAVRPAVQVDLPGTFFVDADLLEQVGLVRPPALAVDAPLYAGSLTANGVHLADEDSFRQAGDTHFAFVVPERANEDVVTIGQALE… |
| I4Z4L1 | 297-541 | APIRIPRSFFFNTRCLVDLLGLHPQVERPQVSRERYLASAKRLGLHLVDSKQGFRRDGDVLFAWAVPEPAFEDIDVLAHLLRRGVLS… |
| A0A849U1N7 | 386-628 | None |
| A0A1D9G531 | 4-207 | None |
| A0A175WG83 | 623-853 | None |
| Q2GTT9 | 285-574 | None |
| A0A3N4KAU4 | 320-572 | None |
| A0A4Q4YBH1 | 309-574 | None |
| A0A2Z6RDG1 | 510-743 | None |
| A0A835YPY8 | 96-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.