DPCstruct | MC7069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 180 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2NC71 | 61-223 | KTDKHEAAFVFDSTEIESGAYGPEVISRVLPLLDKRVTQSVLCGDILCKDQELAFEVLKESMLLSRSFAFRHSSLLYAVYLNNLSSA… |
| B9TDN7 | 1-174 | MIIAVLFNSDDPKFDGYYGPPIRDMIFKTSVLQKSDRHMQVRHGDVLILSNSETRDAYVRLAEDTYFHADWSLTKAKRIRATYLRQT… |
| A0A1N6JYK0 | 1-201 | None |
| A0A401MU01 | 333-519 | None |
| A0A1Y2NYP7 | 199-387 | None |
| A0A439RIA8 | 3-204 | None |
| A0A2E2LA46 | 50-211 | None |
| A0A315XXI5 | 49-229 | None |
| A0A1N6I6H0 | 31-233 | None |
| A0A410Q1W3 | 63-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.