DPCstruct | MC7068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 228 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9TCZ5 | 3-234 | LRSATLRPDEIVAADGALQVAPFEPAIRTHFALRFGTQDEEAGAVARKESVQAAFNSPFWPFVLASTSVGQEGLDFHTWCHSVIHWN… |
| A0A2E6RF62 | 604-824 | RASRVQAKFYEGNGSSVTTSVTRLRAVLALRFARIQSDEGAISQDAVRSSFNSPFRPFVLASTSVGQEGLDFHPWCHRLIHWNLPGN… |
| A0A1C4YDY7 | 70-267 | None |
| A0A175R6B3 | 46-284 | None |
| A0A0A6CZ84 | 9-192 | None |
| A0A7C2FM82 | 267-492 | None |
| A0A2N7SS09 | 870-1118 | None |
| A0A7K2BIA2 | 753-985 | None |
| A0A7G3D8H3 | 286-508 | None |
| A0A525VY38 | 750-1023 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.