DPCstruct | MC7065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A100HWI3 | 14-91 | MREYRPRSVQELAACTCDRCQRHLTPEDSDWRERLSFDHTGGFGSVYGDCNTVSLDLCQHCVQEVLGQWLRITPPADG |
| B9T7F7 | 38-114 | MLDYEEKTVLEIAGCTCDRCRQRMTPVDFAFHERLSVRFLAGFDSIFGDGNVVSIDLCSRCLNETLGDWLHITPPEG |
| A0A7W2N2J5 | 1-93 | None |
| A0A6P2FYI3 | 1-85 | None |
| A0A7C9K809 | 1-87 | None |
| A0A522RMG6 | 1-90 | None |
| A0A1L6F850 | 50-132 | None |
| A0A4R5H0C2 | 1-95 | None |
| A0A4P7CJS0 | 1-85 | None |
| D0J6E8 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.