DPCstruct | MC7061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 529 ± 54 aa |
| Standard deviation of domain lengths | 54.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A088F0H5 | 537-1028 | GDIASGGMNVKFNGDSLFIGSPYSSDRQLVKRITHFRPTSFTNNPNVNFISSYLASFNDIEISLTAIKSEGDDICPLSANGGHIAGN… |
| A0A847L094 | 1-612 | MKTLKLIAYLKVLIVLSLCCSPSQVNVSNIILNENDIKLSVGDEFTLVANLYPENITESQTIKWASSDEKVCTVSQGVVTAVGVGSA… |
| A0A220W6K6 | 315-901 | None |
| G8R3T2 | 205-692 | None |
| A0A7X7MIY6 | 1-516 | None |
| A0A418NJR6 | 395-920 | None |
| A0A0Q7QJB6 | 355-777 | None |
| A0A270BEX7 | 254-787 | None |
| A0A412QSS3 | 667-1181 | None |
| A0A270BKQ0 | 240-836 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.