DPCstruct | MC7060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 217 ± 29 aa |
| Standard deviation of domain lengths | 28.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 94.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1NZF9 | 77-268 | DHGVSRFGIYSNTIESLSEPGVVMVSQDVNGNGLPDDAWYTLAGDQYNNALKNYKITYYNPGTNADVKWKDNQGDSGTVAINAYHTQ… |
| A0A847ISI3 | 1-197 | DHSIVNDGGYNLQITGNTHENSSEPGIVWVMQDSNGNGLPDDTWYELRGSEHSNNRTTRSYAVTYFRQRETGRPVYWTDNEGSTGTI… |
| A0A1V5HFW8 | 28-245 | None |
| A0A7X9Y1A6 | 196-443 | None |
| R6Q4T1 | 1-235 | None |
| A0A512RSQ3 | 58-315 | None |
| A0A847ITE9 | 210-406 | None |
| A0A847KYP4 | 254-491 | None |
| L1N8R8 | 54-278 | None |
| A0A645FGC2 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.