DPCstruct | MC7059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 214 ± 39 aa |
| Standard deviation of domain lengths | 39.00 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3F190 | 1-212 | QESVTLEGFELSTELRSQAEQESGLGPRTLPATAASAVLLGEHVYSSRACANKPSVGCARLRWSHAPAQVVSVLAAKLRTRLKPWPS… |
| A0A812YWJ9 | 169-425 | SVQVGPLAVGKDLIQGGGSGYGGMHADMSNPISLHSFAHKFKAAHTLAGPPAHGFASITPHNTAIGPTGSYVVTCSVQRFGCMRLSY… |
| A0A3S1AD77 | 14-213 | None |
| A0A1W9X7X0 | 136-402 | None |
| K0TQ15 | 862-1132 | None |
| R1D319 | 1-179 | None |
| A0A2U8WSU1 | 407-595 | None |
| A0A3F2S0V4 | 105-358 | None |
| A0A024G4H5 | 532-798 | None |
| A0A485KH74 | 16-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.