DPCstruct | MC7057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 179 ± 28 aa |
| Standard deviation of domain lengths | 27.81 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2RS22 | 794-1003 | IQDLVMIGIMLIWRYLFINRLWPIFFALAPAFQILPNLFVSLMVALDIVRNRYFYRVFYSMTYVSDGIGLLNTIVPVTEIVQEGSEG… |
| A0A7S3F053 | 48-221 | YFYLDDALVTSIPAAATFIVSTYVMVEVAEPGLEGVTYGVLTTAGNLGGPVATALSNGIFGLFHPSLSESDNYVADTPSFRNLVAVS… |
| A0A7S3AWF8 | 10-164 | None |
| A0A1W0A6I4 | 872-1079 | None |
| A0A7S1ZVW7 | 17-224 | None |
| W2M0N6 | 55-220 | None |
| A0A2P4YSF0 | 118-336 | None |
| A0A0P1B3P1 | 361-554 | None |
| A0A397F3F7 | 1044-1245 | None |
| A0A812YIN1 | 1-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.