DPCstruct | MC7056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4TA95 | 370-473 | SYLAIEGGGDLLNAWESSLADKKDIQLVYVRPEEWRANLLTQKERKSGRLSKEAARLIARQVVSDFGSMGDHKGKFKTDAAESVAMG… |
| A0A838WC53 | 1-104 | HTLPDLAWLILEGGGNLAEIWTREAERRGIPVRRIPAERWRGELLYAREQRSGAQAKQHAAELARRIIEWSAAPRPTSLRHDAAEAI… |
| A0A7S0LAM5 | 184-310 | None |
| A0A7S2A2J4 | 734-850 | None |
| A0A1E7FJB4 | 910-1034 | None |
| A0A6P1ZDN2 | 42-142 | None |
| A0A7S2V8E1 | 753-879 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.