DPCstruct | MC7053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 88 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3EWQ1 | 3-88 | KRPPAIAAWLTGVDLAYVKAILESREILLEVGLDTQYLLARMRTGGQSMEAQQYEEAKLRTRGLHFLSVQEGPESEQPDGFWLLKD |
| A0A6U0AVY2 | 363-450 | FSRRAMPLAAWTNGLEMGMIEVDRDRSCLILETGVGKRWRYASYRASEQADAEGAAWEAAKQQSGGLHFLAVQGSPDDEPTGLWLLWD |
| A0A7J8WZC1 | 1-83 | None |
| A0A813JW54 | 26-127 | None |
| T2J6W4 | 3-88 | None |
| A0A2N9GIK0 | 330-424 | None |
| B5ILL3 | 10-93 | None |
| A0A6U0UCW5 | 157-243 | None |
| A0A5E4G9Y5 | 102-190 | None |
| A0A2K3KXI4 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.