DPCstruct | MC7052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 148 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4RXT9 | 367-510 | AFSWARLETDPARRGWVQRKVLRDALWNAVATHKNVHFAFSYASQAPAEDALGGIIDAHVAQLRLFPPAPQLSLTLDLRGLYPQDPA… |
| A0A7S3EWG6 | 10-165 | YLAIHYACSLPHAAAATAAMCAAIAEAFTVSLRRAYAAVRPQEAALFSLVYATIEHGTPEAAEAAAVGLHALSRYPAELVEWPTDNT… |
| A0A1F9UGD8 | 9-146 | None |
| A0A212IZ18 | 666-821 | None |
| A0A7C2WKU3 | 1-106 | None |
| A0A7C3SVU3 | 179-359 | None |
| A0A352XIP7 | 12-133 | None |
| A0A7X7A2X6 | 12-146 | None |
| A0A2H5X604 | 275-408 | None |
| A0A813UMA5 | 93-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.