DPCstruct | MC7050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 140 ± 26 aa |
| Standard deviation of domain lengths | 25.88 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7FMM4 | 22-170 | QAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSK… |
| A0A2G8KCF0 | 5-121 | HSDLTAPNSIGNMALLPINTKFRGPAPPGDGSKDIIDEAIYFFKANIFFKNYEVKTPADRVLIYLTLYITECLKKLQRCTSKVQGAK… |
| A0A3P7IEY2 | 135-329 | None |
| A0A2U1J051 | 129-278 | None |
| A0A4D9A466 | 13-156 | None |
| A0A0B7NNP9 | 2-127 | None |
| A0A0F4YPZ9 | 1-164 | None |
| D3BMV1 | 1-167 | None |
| A0A5F8A4E7 | 1-104 | None |
| A0A2I3TP38 | 9-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.