DPCstruct | MC705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433DD38 | 1-80 | MLSNDIIDRLDYPVYWSRPHTEWGSIVDWDMFYIDQMPGSTLRDSHQALARDLNTLIDNLLTKSRECQKAKSLQALLNTQ |
| A0A433D512 | 31-120 | RLSKELKGLLHYPEYWDRNASLWGDVVDWDIFFINKTPSCTAKSAHTALSSELDNLLENFPVGSFQHKKALALRAAIKVKFLIFSDK… |
| U9UEZ6 | 52-135 | None |
| A0A2N1N6C3 | 2-89 | None |
| A0A2H5SC57 | 1-86 | None |
| A0A2Z6RGU7 | 27-123 | None |
| A0A2I1EYJ4 | 1-82 | None |
| A0A372Q4N2 | 2-83 | None |
| A0A2N0QNT5 | 69-153 | None |
| A0A397U0K0 | 4-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.