DPCstruct | MC7048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 15.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B7G2R3 | 507-612 | GSLFVHVGEFRGLTGNSTFEQLLMDDFALLQRFPCLPWGTDAAELTIWRRRKASDNTSKSRLLPCSSCGTRESVQRLRLVRYLTYCS… |
| R1E0T9 | 575-713 | GDTVVHVGEWLGDTGSAAFEAALAEGWELTRRLPLPCWGDTAEDLTIWRRRGGGVPRGGGGAADHPVLRCDSCGKAGSLQPATVRDK… |
| A0A7S0GWH5 | 261-407 | None |
| A0A7S3SZA6 | 272-402 | None |
| A0A7S1WXZ1 | 439-595 | None |
| A0A7S3HF95 | 51-211 | None |
| A0A7S3WNZ3 | 92-230 | None |
| A0A7S3W5Z6 | 378-525 | None |
| A0A812YIW7 | 213-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.