DPCstruct | MC7045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 110 ± 18 aa |
| Standard deviation of domain lengths | 17.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7FQL6 | 5-93 | QKMMAQVKEAGLAGVISYALWELGFWAISVPVCIFGYYEVTGHFPDLTNAEDQGKLGAEAFAFVNFARFAVPLRIGLALGTTPWIDE… |
| A0A7S3BNT6 | 71-174 | EEEEELSESKKMLQQVKDAGIAGIISYVFWEWAFWGVSVPVCIVGYQAATGHWPDFSNQDDIAKLGAEAFAFVNVARFAIPLRIGLA… |
| A0A7S3ZUG5 | 22-137 | None |
| A0A1Q9CHF3 | 53-198 | None |
| A0A7S2USK8 | 78-198 | None |
| R1BXT4 | 89-218 | None |
| A0A7R9WMW2 | 55-170 | None |
| A0A7S3F477 | 2-80 | None |
| A0A7S0LKV6 | 78-189 | None |
| A0A812YVW2 | 170-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.