DPCstruct | MC7044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 295 |
|---|---|
| Mean domain length (aa) | 126 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 95.93 |
| Assigned Pfam label(s) | PF09409- CL0125- CL0126- CL0020- PF21388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PKV6 | 2-112 | AEAQSALHRLAESPWEKQETCYITLLKVLNNIVEHPAEAKFRHLKTSNAALRAKVFDLPGAKEFLLSSGFTEEEGGEVLDCPAGQEA… |
| A0A7S3BGT7 | 21-154 | VDDLPTVTERVVTADDLTVAEARKHVLRALDTRISQQDGAGALQAIDVADKLAANIVANPSEPRYQRFRSNNPSISRKLLQFPGGTE… |
| A0A504WT23 | 52-230 | None |
| B7PB47 | 276-380 | None |
| A0A7S2XMR4 | 316-421 | None |
| A0A7S3ZT94 | 218-343 | None |
| A0A7S3ZP24 | 7-147 | None |
| K8EGG9 | 1-144 | None |
| A0A834Y3S3 | 4-107 | None |
| A0A1A8ZQ72 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.