DPCstruct | MC7043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 148 ± 19 aa |
| Standard deviation of domain lengths | 19.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3BAH9 | 11-169 | AAGGEPAARYEAAYALITRAETVTRFAARGAAEPGKPAFPAELADPNAEPNETYLPSLDICLRHVATALLIGADAAAAAAHADLSGH… |
| A0A1Z5KGC1 | 210-361 | GSWELPLEPHNGGVEPDWIWAGDEASARREAAERLSANHIAIVRFAARGAGRKGMPPVSAPLADPNAVPSEAVIGSVDAILRIVCMA… |
| A0A7S2RAY5 | 12-129 | None |
| A0A7S0CFM3 | 1-139 | None |
| A0A812KI55 | 296-452 | None |
| A0A812J8C9 | 607-764 | None |
| R1ECD5 | 289-416 | None |
| R1E936 | 427-554 | None |
| A0A813DP77 | 90-245 | None |
| A0A7S2CNL6 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.