DPCstruct | MC7042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 152 ± 22 aa |
| Standard deviation of domain lengths | 22.03 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D7CQE4 | 89-227 | SNSWVEISHCANKVAKNREKVGAWYYYAPGSGVYLNLGKTKVYQKHPNAVKDILKETCFDSECDKFYPKLFKTAKEQGYDTIQFLNH… |
| A0A7S3B9Q3 | 2-173 | NTWVEVTHSATPGDEACGAWFYRGTGSGIWFNMGKTMAFHEHGDAVKQFPGGKTATCKTGDEAMSNAAAKAGYDSIQFLGHNDGGTN… |
| A0A7S3APJ2 | 10-174 | None |
| A0A7S3AI47 | 187-350 | None |
| A0A0G4F3R6 | 200-365 | None |
| A0A7S3F385 | 236-417 | None |
| A0A7S3F1W8 | 8-137 | None |
| A0A7S0LFJ3 | 2-137 | None |
| A0A7S3SRS7 | 210-390 | None |
| A0A7S4JAW5 | 3-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.