DPCstruct | MC7041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3B8Y0 | 1-114 | MEAAVLRAHPEWGGSRVGDEVQAFSDFLFYVLDSPTLISELAIAIFDSESGFVEIFSGSQYKKSERGAEQRTNLLVIRYVPGHYQAL… |
| A0A7S1A955 | 234-360 | LHLKRAIEANVLATRPAWAAGIDDESGTPMAFADFLPIMMHAEDANLVAELAVCILDSVAGHVEVYLGPKYADMDAATKERNLILLW… |
| A0A7J6TKN3 | 94-227 | None |
| A0A7S3JZX2 | 390-530 | None |
| A0A7S4IIR5 | 68-200 | None |
| A0A812S6H5 | 92-215 | None |
| A0A813GXZ5 | 113-251 | None |
| A0A7S4SSM4 | 489-662 | None |
| A0A812MQK2 | 456-581 | None |
| A0A7S0B202 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.